PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g02690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 249aa    MW: 27334.5 Da    PI: 6.7753
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g02690genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.44.2e-18169203135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  Tp5g02690 169 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 203
                *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.4E-872247IPR016679Transcription factor, GATA, plant
SuperFamilySSF577161.05E-14161225No hitNo description
Gene3DG3DSA:3.30.50.101.0E-13163201IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.754163199IPR000679Zinc finger, GATA-type
SMARTSM004012.9E-16163213IPR000679Zinc finger, GATA-type
CDDcd002026.81E-14168215No hitNo description
PfamPF003206.7E-16169203IPR000679Zinc finger, GATA-type
PROSITE patternPS003440169194IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDVYGLSSPD LLRIDDLLDF SNDEIFSSSS TVVSSAASSA ASSENPFSFP SSASTSFHTS  60
PAPPPLLTDF THDLCVPSDD AAHLEWLSRF VDDSFSDYPA NPLTMTVRPE MSFTGKPRSR  120
RSRAPAPSVA GTWAPMPESE LCYSVAKRKP NQKFEAESMT ADGGEARRCT HCASEKTPQW  180
RTGPLGPKTL CNACGVRFKS GRLVPEYRPA SSPTFVLTQH SNSHRKVMEL RRQKEQLESA  240
VQLPPFQSQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531960.0AK353196.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-22-H09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402573.11e-150hypothetical protein EUTSA_v10006202mg
SwissprotO497431e-136GATA4_ARATH; GATA transcription factor 4
TrEMBLE4MXE91e-150E4MXE9_EUTHA; mRNA, clone: RTFL01-22-H09
TrEMBLV4NDG21e-150V4NDG2_EUTSA; Uncharacterized protein
STRINGBra003419.1-P1e-135(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-113GATA transcription factor 4